Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1
LigandBDBM50193518
Substrate/Competitorn/a
Meas. Tech.ChEMBL_385201
Ki 314±n/a nM
Citation Xu YJiang GTsukahara RFujiwara YTigyi GPrestwich GD Phosphonothioate and fluoromethylene phosphonate analogues of cyclic phosphatidic acid: Novel antagonists of lysophosphatidic acid receptors. J Med Chem 49:5309-15 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1
Name:Lysophosphatidic acid receptor 1
Synonyms:LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2
Type:Enzyme
Mol. Mass.:41120.55
Organism:Homo sapiens (Human)
Description:Q92633
Residue:364
Sequence:
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193518
n/a
NameBDBM50193518
Synonyms:3-hydroxyl-4-palmitoyloxylbutane 1,3-cyclic phosphonothioate | CHEMBL211465
TypeSmall organic molecule
Emp. Form.C20H39O4PS
Mol. Mass.406.56
SMILESCCCCCCCCCCCCCCCC(=O)OCC1CCP(O)(=S)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: