| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50054131 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2268392 |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Giordani, A; Menziani, MC; Moresco, RM; Matarrese, M; Paolino, M; Saletti, M; Giuliani, G; Anzini, M; Cappelli, A Exploring Translocator Protein (TSPO) Medicinal Chemistry: An Approach for Targeting Radionuclides and Boron Atoms to Mitochondria. J Med Chem64:9649-9676 (2021) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50054131 |
|---|
| n/a |
|---|
| Name | BDBM50054131 |
|---|
| Synonyms: | 2-[2-(4-Chloro-phenyl)-1-oxo-2,3-dihydro-1H-pyrrolo[3,4-b]quinolin-3-yl]-N,N-dihexyl-acetamide | CHEMBL335049 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H38ClN3O2 |
|---|
| Mol. Mass. | 520.105 |
|---|
| SMILES | CCCCCCN(CCCCCC)C(=O)Cc1n(-c2ccc(Cl)cc2)c(=O)c2cc3ccccc3[nH]c12 |
|---|
| Structure | 
|
|---|
Search and Browse
