| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50378901 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2268393 |
|---|
| Kd | 10.0±n/a nM |
|---|
| Citation |  Giordani, A; Menziani, MC; Moresco, RM; Matarrese, M; Paolino, M; Saletti, M; Giuliani, G; Anzini, M; Cappelli, A Exploring Translocator Protein (TSPO) Medicinal Chemistry: An Approach for Targeting Radionuclides and Boron Atoms to Mitochondria. J Med Chem64:9649-9676 (2021) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50378901 |
|---|
| n/a |
|---|
| Name | BDBM50378901 |
|---|
| Synonyms: | CHEMBL1672418 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21IN2O |
|---|
| Mol. Mass. | 444.3087 |
|---|
| SMILES | CCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1I |
|---|
| Structure | 
|
|---|
Search and Browse
