| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50196031 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_416892 (CHEMBL909448) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Wang, G; Nikolovska-Coleska, Z; Yang, CY; Wang, R; Tang, G; Guo, J; Shangary, S; Qiu, S; Gao, W; Yang, D; Meagher, J; Stuckey, J; Krajewski, K; Jiang, S; Roller, PP; Abaan, HO; Tomita, Y; Wang, S Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. J Med Chem49:6139-42 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50196031 |
|---|
| n/a |
|---|
| Name | BDBM50196031 |
|---|
| Synonyms: | CHEMBL216213 | N-[(2-Tert-butyl-benzenesulfonyl)-phenyl]-2,3,4-trimethoxyl-5-(2-isopropyl-benzyl)-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H41NO6S |
|---|
| Mol. Mass. | 615.779 |
|---|
| SMILES | COc1c(Cc2ccccc2C(C)C)cc(C(=O)Nc2ccc(cc2)S(=O)(=O)c2ccccc2C(C)(C)C)c(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
