Reaction Details |
| Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50203200 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_425211 (CHEMBL855157) |
---|
Ki | 0.77±n/a nM |
---|
Citation | D'Amico, DC; Aya, T; Human, J; Fotsch, C; Chen, JJ; Biswas, K; Riahi, B; Norman, MH; Willoughby, CA; Hungate, R; Reider, PJ; Biddlecome, G; Lester-Zeiner, D; Staden, CV; Johnson, E; Kamassah, A; Arik, L; Wang, J; Viswanadhan, VN; Groneberg, RD; Zhan, J; Suzuki, H; Toro, A; Mareska, DA; Clarke, DE; Harvey, DM; Burgess, LE; Laird, ER; Askew, B; Ng, G Identification of a nonpeptidic and conformationally restricted bradykinin B1 receptor antagonist with anti-inflammatory activity. J Med Chem50:607-10 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50203200 |
---|
n/a |
---|
Name | BDBM50203200 |
Synonyms: | (R)-3-(naphthalene-7-sulfonamido)-3-phenyl-N-((R)-7-(piperidin-1-ylmethyl)-3,4-dihydro-2H-chromen-4-yl)propanamide | (R)-3-(naphthalene-7-sulfonamido)-3-phenyl-N-((R)-7-(piperidin-1-ylmethyl)chroman-4-yl)propanamide | CHEMBL415848 |
Type | Small organic molecule |
Emp. Form. | C34H37N3O4S |
Mol. Mass. | 583.74 |
SMILES | O=C(C[C@@H](NS(=O)(=O)c1ccc2ccccc2c1)c1ccccc1)N[C@@H]1CCOc2cc(CN3CCCCC3)ccc12 |
Structure |
|