Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50206658 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_438448 (CHEMBL887548) |
---|
Ki | 50±n/a nM |
---|
Citation | Lee, YS; Nyberg, J; Moye, S; Agnes, RS; Davis, P; Ma, SW; Lai, J; Porreca, F; Vardanyan, R; Hruby, VJ Understanding the structural requirements of 4-anilidopiperidine analogues for biological activities at mu and delta opioid receptors. Bioorg Med Chem Lett17:2161-5 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50206658 |
---|
n/a |
---|
Name | BDBM50206658 |
Synonyms: | (S)-N-(1-(2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl)piperidin-4-yl)-N-phenylpropionamide | CHEMBL231253 |
Type | Small organic molecule |
Emp. Form. | C25H33N3O3 |
Mol. Mass. | 423.5478 |
SMILES | CCC(=O)N(C1CCN(CC1)C(=O)[C@@H](N)Cc1c(C)cc(O)cc1C)c1ccccc1 |
Structure |
|