Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50207994
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429171
Ki 16.5±n/a nM
Citation Peretto IForlani RFossati CGiardina GAGiardini AGuala MLa Porta EPetrillo PRadaelli SRadice LRaveglia LFSantoro EScudellaro RScarpitta FBigogno CMisiano PDondio GMRizzi AArmani EAmari GCivelli MVilletti GPatacchini RBergamaschi MDelcanale MSalcedo CFernández AGImbimbo BP Discovery of diaryl imidazolidin-2-one derivatives, a novel class of muscarinic M3 selective antagonists (Part 1). J Med Chem 50:1571-83 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207994
n/a
NameBDBM50207994
Synonyms:3-(1-(4-chlorobenzyl)-piperidin-4-yl)-5,5-diphenyl-imidazolidin-2-one | CHEMBL269280
TypeSmall organic molecule
Emp. Form.C27H28ClN3O
Mol. Mass.445.984
SMILESClc1ccc(CN2CCC(CC2)N2CC(NC2=O)(c2ccccc2)c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: