| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50149384 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_436687 (CHEMBL904996) |
|---|
| IC50 | 0.26±n/a nM |
|---|
| Citation |  Li, T; Shiotani, K; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Jinsmaa, Y; Marczak, E; Bryant, SD; Lazarus, LH; Okada, Y Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mixed mu-agonist/delta-antagonist and dual mu-agonist/delta-agonist opioid ligands. J Med Chem50:2753-66 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50149384 |
|---|
| n/a |
|---|
| Name | BDBM50149384 |
|---|
| Synonyms: | (S)-1-[(S)-2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-pyrrolidine-2-carboxylic acid [(S)-1-((S)-1-carbamoyl-2-phenyl-ethylcarbamoyl)-2-phenyl-ethyl]-amide | CHEMBL331325 | Dmt-Pro-Phe-Phe-NH2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41N5O5 |
|---|
| Mol. Mass. | 599.7198 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
