Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50212619 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_436687 (CHEMBL904996) |
---|
IC50 | 1.94±n/a nM |
---|
Citation | Li, T; Shiotani, K; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Jinsmaa, Y; Marczak, E; Bryant, SD; Lazarus, LH; Okada, Y Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mixed mu-agonist/delta-antagonist and dual mu-agonist/delta-agonist opioid ligands. J Med Chem50:2753-66 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50212619 |
---|
n/a |
---|
Name | BDBM50212619 |
Synonyms: | CHEMBL388800 | Dmt-Pro-Dmt-Phe-NH2 |
Type | Small organic molecule |
Emp. Form. | C35H43N5O6 |
Mol. Mass. | 629.7458 |
SMILES | Cc1cc(O)ccc1C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1c(C)cc(O)cc1C)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |
Structure |
|