Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TXK
LigandBDBM50212764
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447354
IC50 1400±n/a nM
Citation Snow RJAbeywardane ACampbell SLord JKashem MAKhine HHKing JKowalski JAPullen SSRoma TRoth GPSarko CRWilson NSWinters MPWolak JPCywin CL Hit-to-lead studies on benzimidazole inhibitors of ITK: discovery of a novel class of kinase inhibitors. Bioorg Med Chem Lett 17:3660-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TXK
Name:Tyrosine-protein kinase TXK
Synonyms:PTK4 | Protein-tyrosine kinase 4 | RLK | Resting lymphocyte kinase | TXK | Tyrosine-protein kinase TXK (TXK)
Type:Protein
Mol. Mass.:61268.80
Organism:Homo sapiens (Human)
Description:P42681
Residue:527
Sequence:
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212764
n/a
NameBDBM50212764
Synonyms:CHEMBL233338 | N-(1-(3-aminopropyl)-5-(N-methylcyclohexanecarboxamido)-1H-benzo[d]imidazol-2-yl)thiophene-2-carboxamide
TypeSmall organic molecule
Emp. Form.C23H29N5O2S
Mol. Mass.439.574
SMILESCN(C(=O)C1CCCCC1)c1ccc2n(CCCN)c(NC(=O)c3cccs3)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: