| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcription factor Jun |
|---|
| Ligand | BDBM50213934 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_456206 (CHEMBL888216) |
|---|
| IC50 | 110±n/a nM |
|---|
| Citation |  Gao, W; Bussom, S; Grill, SP; Gullen, EA; Hu, YC; Huang, X; Zhong, S; Kaczmarek, C; Gutierrez, J; Francis, S; Baker, DC; Yu, S; Cheng, YC Structure-activity studies of phenanthroindolizidine alkaloids as potential antitumor agents. Bioorg Med Chem Lett17:4338-42 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcription factor Jun |
|---|
| Name: | Transcription factor Jun |
|---|
| Synonyms: | AP1 | Activator protein 1 | JUN | JUN_HUMAN | Proto-oncogene c-JUN | Transcription factor AP-1 | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 35683.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05412 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
|
|
|
|---|
| BDBM50213934 |
|---|
| n/a |
|---|
| Name | BDBM50213934 |
|---|
| Synonyms: | CHEMBL398325 | tylophorinine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25NO4 |
|---|
| Mol. Mass. | 379.4489 |
|---|
| SMILES | COc1ccc2c3[C@@H](O)[C@@H]4CCCN4Cc3c3cc(OC)c(OC)cc3c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
