Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein Kinase II
LigandBDBM50214446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_439083
Ki 24±n/a nM
Citation Nie ZPerretta CErickson PMargosiak SAlmassy RLu JAverill AYager KMChu S Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2. Bioorg Med Chem Lett 17:4191-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein Kinase II
Name:Casein Kinase II
Synonyms:CK II | CK2- alpha
Type:Enzyme
Mol. Mass.:39238.74
Organism:Zea mays (Maize)
Description:n/a
Residue:332
Sequence:
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY
PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLL
RYDHQERLTALEAMTHPYFQQVRAAENSRTRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214446
n/a
NameBDBM50214446
Synonyms:2,4-bis(phenylamino)pyrazolo[1,5-a][1,3,5]triazine-8-carbonitrile | CHEMBL396230
TypeSmall organic molecule
Emp. Form.C18H13N7
Mol. Mass.327.3427
SMILESN#Cc1cnn2c(Nc3ccccc3)nc(Nc3ccccc3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: