Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP/microtubule affinity-regulating kinase 2
LigandBDBM50218709
Substrate/Competitorn/a
Meas. Tech.ChEMBL_444998
IC50>10000±n/a nM
Citation Wang LSullivan GMHexamer LAHasvold LAThalji RPrzytulinska MTao ZFLi GChen ZXiao ZGu WZXue JBui MHMerta PKovar PBouska JJZhang HPark CStewart KDSham HLSowin TJRosenberg SHLin NH Design, synthesis, and biological activity of 5,10-dihydro-dibenzo[b,e][1,4]diazepin-11-one-based potent and selective Chk-1 inhibitors. J Med Chem 50:4162-76 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP/microtubule affinity-regulating kinase 2
Name:MAP/microtubule affinity-regulating kinase 2
Synonyms:ELKL motif kinase 1 | EMK1 | MARK2 | PAR1 homolog | Par-1 | Serine/threonine-protein kinase MARK2
Type:PROTEIN
Mol. Mass.:87953.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774586
Residue:788
Sequence:
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50218709
n/a
NameBDBM50218709
Synonyms:2-[3-(3-methoxy-4-nitrophenyl)-11-oxo-10,11-dihydro-5Hdibenzo[b,e][1,4]diazepin-8-yl]-2-methyl-N-(4-morpholin-4-ylphenyl)propanamide | CHEMBL389745
TypeSmall organic molecule
Emp. Form.C34H35N5O4
Mol. Mass.577.6728
SMILESCOc1cc(ccc1N)-c1ccc2c(Nc3ccc(cc3NC2=O)C(C)(C)C(=O)Nc2ccc(cc2)N2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: