Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProteinase-activated receptor 1
LigandBDBM50222015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_446321
IC50 10.5±n/a nM
Citation Chelliah MVChackalamannil SXia YEagen KClasby MCGao XGreenlee WAhn HSAgans-Fantuzzi JBoykow GHsieh YBryant MPalamanda JChan TMHesk DChintala M Heterotricyclic himbacine analogs as potent, orally active thrombin receptor (protease activated receptor-1) antagonists. J Med Chem 50:5147-60 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proteinase-activated receptor 1
Name:Proteinase-activated receptor 1
Synonyms:Coagulation factor II receptor | PAR-1 | Proteinase activated receptor 1 | Proteinase-activated receptor 1 (PAR-1) | Thrombin receptor | Thrombin receptor/ Proteinase-activated receptor 1(Par-1)
Type:Protein
Mol. Mass.:47450.07
Organism:Homo sapiens (Human)
Description:P25116
Residue:425
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50222015
n/a
NameBDBM50222015
Synonyms:(1R,3aR,4aS,8aS,9S,9aS)-decahydro-1-methyl-3-oxo-9-[(1E)-2-[5-(3-fluorophenyl)-2-pyridinyl]ethenyl]-furo[3,4-g]isoquinoline-6(3H)-carboxylic acid ethyl ester | CHEMBL390630
TypeSmall organic molecule
Emp. Form.C28H31FN2O4
Mol. Mass.478.5551
SMILESCCOC(=O)N1CC[C@@H]2[C@H](C[C@@H]3[C@@H]([C@@H](C)OC3=O)[C@H]2\C=C\c2ccc(cn2)-c2cccc(F)c2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: