| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50222943 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_459563 (CHEMBL925663) |
|---|
| IC50 | 61500±n/a nM |
|---|
| Citation |  Zheng, CJ; Lee, S; Lee, CH; Kim, WG Macrolactins O-R, glycosylated 24-membered lactones from Bacillus sp. AH159-1. J Nat Prod70:1632-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_STAAU | PDF | Peptide Deformylase | Polypeptide deformylase | def | def1 | pdf1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 20556.80 |
|---|
| Organism: | Staphylococcus aureus (strain Mu50 / ATCC 700699) |
|---|
| Description: | ChEMBL_459563 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
|
|
|
|---|
| BDBM50222943 |
|---|
| n/a |
|---|
| Name | BDBM50222943 |
|---|
| Synonyms: | CHEMBL399871 | macrolactin R |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H44O10 |
|---|
| Mol. Mass. | 564.6644 |
|---|
| SMILES | C[C@@H]1CCC\C=C\C=C\[C@H](O)C[C@@H](O)C\C=C\C=C\[C@H](C\C=C\C=C/C(=O)O1)O[C@H]1O[C@@H](CO)[C@H](O)[C@@H](O)[C@@H]1O |c:23,t:5,7,15,17,21| |
|---|
| Structure | 
|
|---|
Search and Browse
