Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase CHK2
LigandBDBM50224986
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458529
IC50 70±n/a nM
Citation Neff DKLee-Dutra ABlevitt JMAxe FUHack MDBuma JCRynberg RBrunmark AKarlsson LBreitenbucher JG 2-Aryl benzimidazoles featuring alkyl-linked pendant alcohols and amines as inhibitors of checkpoint kinase Chk2. Bioorg Med Chem Lett 17:6467-71 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase CHK2
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:Cds1
Type:Protein
Mol. Mass.:60908.59
Organism:Homo sapiens (Human)
Description:O96017
Residue:543
Sequence:
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224986
n/a
NameBDBM50224986
Synonyms:2-{4-[1-(4-methyl-benzyl)-piperidin-4-ylmethoxy]-phenyl}-1H-benzoimidazole-5-carboxylic acid amide | CHEMBL398467
TypeSmall organic molecule
Emp. Form.C28H30N4O2
Mol. Mass.454.5634
SMILESCc1ccc(CN2CCC(COc3ccc(cc3)-c3nc4ccc(cc4[nH]3)C(N)=O)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: