Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50227182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_461490 (CHEMBL927501) |
---|
IC50 | 450±n/a nM |
---|
Citation | Moulin, A; Demange, L; Ryan, J; M'Kadmi, C; Galleyrand, JC; Martinez, J; Fehrentz, JA Trisubstituted 1,2,4-triazoles as ligands for the ghrelin receptor: on the significance of the orientation and substitution at position 3. Bioorg Med Chem Lett18:164-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50227182 |
---|
n/a |
---|
Name | BDBM50227182 |
Synonyms: | (R)-benzyl 3-(5-(2-(1H-indol-3-yl)ethyl)-4-(4-methoxybenzyl)-4H-1,2,4-triazol-3-yl)-3-(2-amino-2-methylpropanamido)propanoate | CHEMBL252501 |
Type | Small organic molecule |
Emp. Form. | C34H38N6O4 |
Mol. Mass. | 594.7033 |
SMILES | COc1ccc(Cn2c(CCc3c[nH]c4ccccc34)nnc2[C@@H](CC(=O)OCc2ccccc2)NC(=O)C(C)(C)N)cc1 |
Structure |
|