Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 3
LigandBDBM50227864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461636
Ki 6±n/a nM
Citation Watson RJAllen DRBirch HLChapman GAGalvin FCJopling LAKnight RLMeier DOliver KMeissner JWOwen DAThomas EJTremayne NWilliams SC Development of CXCR3 antagonists. Part 3: Tropenyl and homotropenyl-piperidine urea derivatives. Bioorg Med Chem Lett 18:147-51 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 3
Name:C-X-C chemokine receptor type 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41020.84
Organism:Mus musculus
Description:ChEMBL_560734
Residue:367
Sequence:
MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGP
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLL
FALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227864
n/a
NameBDBM50227864
Synonyms:1-(1-((9-acetyl-9-aza-bicyclo[3.3.1]non-2-en-3-yl)methyl)piperidin-4-yl)-3-(3-fluoro-5-isopropoxyphenyl)urea | CHEMBL253248
TypeSmall organic molecule
Emp. Form.C26H37FN4O3
Mol. Mass.472.5954
SMILESCC(C)Oc1cc(F)cc(NC(=O)NC2CCN(CC3=CC4CCCC(C3)N4C(C)=O)CC2)c1 |w:25.25,21.20,t:19,TLB:28:27:19.26.20:22.24.23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: