| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50229596 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_460136 (CHEMBL924983) |
|---|
| Ki | 4.5±n/a nM |
|---|
| Citation |  Briard, E; Zoghbi, SS; Imaizumi, M; Gourley, JP; Shetty, HU; Hong, J; Cropley, V; Fujita, M; Innis, RB; Pike, VW Synthesis and evaluation in monkey of two sensitive 11C-labeled aryloxyanilide ligands for imaging brain peripheral benzodiazepine receptors in vivo. J Med Chem51:17-30 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50229596 |
|---|
| n/a |
|---|
| Name | BDBM50229596 |
|---|
| Synonyms: | 1-(2-chlorophenyl)-N-methyl-N-[(1S)-1-methylpropyl]isoquinoline-3-carboxamide | CHEMBL251953 | PK-11195 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21ClN2O |
|---|
| Mol. Mass. | 352.857 |
|---|
| SMILES | CC[C@H](C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
