| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50269948 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_505237 (CHEMBL941344) |
|---|
| IC50 | 486±n/a nM |
|---|
| Citation |  Slack-Davis, JK; Martin, KH; Tilghman, RW; Iwanicki, M; Ung, EJ; Autry, C; Luzzio, MJ; Cooper, B; Kath, JC; Roberts, WG; Parsons, JT Cellular characterization of a novel focal adhesion kinase inhibitor. J Biol Chem282:14845-52 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50269948 |
|---|
| n/a |
|---|
| Name | BDBM50269948 |
|---|
| Synonyms: | 6-(4-(3-(methylsulfonyl)benzylamino)-5-(trifluoromethyl)pyrimidin-2-ylamino)-3,4-dihydroquinolin-2(1H)-one | CHEMBL514554 | D3RKN_2 | PF-228 | US10266549, Example 32 | US10774092, Example 32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20F3N5O3S |
|---|
| Mol. Mass. | 491.486 |
|---|
| SMILES | CS(=O)(=O)c1cccc(CNc2nc(Nc3ccc4NC(=O)CCc4c3)ncc2C(F)(F)F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
