| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50261228 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555531 (CHEMBL963791) |
|---|
| Ki | 13±n/a nM |
|---|
| Citation |  Chen, C; Tucci, FC; Jiang, W; Tran, JA; Fleck, BA; Hoare, SR; Wen, J; Chen, T; Johns, M; Markison, S; Foster, AC; Marinkovic, D; Chen, CW; Arellano, M; Harman, J; Saunders, J; Bozigian, H; Marks, D Pharmacological and pharmacokinetic characterization of 2-piperazine-alpha-isopropyl benzylamine derivatives as melanocortin-4 receptor antagonists. Bioorg Med Chem16:5606-18 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50261228 |
|---|
| n/a |
|---|
| Name | BDBM50261228 |
|---|
| Synonyms: | 1-{2-[(1S)-(Methylaminoacetamido)-2-methylpropyl]-4-chlorophenyl}-4-[(2R)-methyl-3-(2-methoxy-4-dichlorophenyl)propionyl]piperazine | CHEMBL467586 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H38Cl2N4O3 |
|---|
| Mol. Mass. | 549.532 |
|---|
| SMILES | CNCC(=O)N[C@@H](C(C)C)c1cc(Cl)ccc1N1CCN(CC1)C(=O)[C@H](C)Cc1ccc(Cl)cc1OC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
