Reaction Details |
| Report a problem with these data |
Target | Bcl2-associated agonist of cell death |
---|
Ligand | BDBM50270876 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_553538 (CHEMBL958721) |
---|
IC50 | 6900±n/a nM |
---|
Citation | Congreve, M; Chessari, G; Tisi, D; Woodhead, AJ Recent developments in fragment-based drug discovery. J Med Chem51:3661-80 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl2-associated agonist of cell death |
---|
Name: | Bcl2-associated agonist of cell death |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
Type: | PROTEIN |
Mol. Mass.: | 18393.69 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_478760 |
Residue: | 168 |
Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
BDBM50270876 |
---|
n/a |
---|
Name | BDBM50270876 |
Synonyms: | 3-((E)-2-Biphenyl-3-yl-vinyl)-4'-fluoro-biphenyl-4-carboxylic acid | CHEMBL485891 |
Type | Small organic molecule |
Emp. Form. | C27H19FO2 |
Mol. Mass. | 394.437 |
SMILES | OC(=O)c1ccc(cc1\C=C\c1cccc(c1)-c1ccccc1)-c1ccc(F)cc1 |
Structure |
|