| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 2-associated protein 1 |
|---|
| Ligand | BDBM50243530 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_491562 (CHEMBL944208) |
|---|
| IC50 | >69000±n/a nM |
|---|
| Citation |  Janetka, JW; Almeida, L; Ashwell, S; Brassil, PJ; Daly, K; Deng, C; Gero, T; Glynn, RE; Horn, CL; Ioannidis, S; Lyne, P; Newcombe, NJ; Oza, VB; Pass, M; Springer, SK; Su, M; Toader, D; Vasbinder, MM; Yu, D; Yu, Y; Zabludoff, SD Discovery of a novel class of 2-ureido thiophene carboxamide checkpoint kinase inhibitors. Bioorg Med Chem Lett18:4242-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 2-associated protein 1 |
|---|
| Name: | Cyclin-dependent kinase 2-associated protein 1 |
|---|
| Synonyms: | CDK2AP1 | CDKA1_HUMAN | CDKAP1 | DOC1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12370.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_491562 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ
SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
|
|
|
|---|
| BDBM50243530 |
|---|
| n/a |
|---|
| Name | BDBM50243530 |
|---|
| Synonyms: | 1-(5-(4-(2-(diethylamino)ethoxy)phenyl)-3-(piperidin-4-ylcarbamoyl)thiophen-2-yl)urea | CHEMBL461294 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H33N5O3S |
|---|
| Mol. Mass. | 459.605 |
|---|
| SMILES | CCN(CC)CCOc1ccc(cc1)-c1cc(C(=O)NC2CCNCC2)c(NC(N)=O)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
