Reaction Details |
| Report a problem with these data |
Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
---|
Ligand | BDBM50266819 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_564958 (CHEMBL957493) |
---|
Ki | >1000000±n/a nM |
---|
Citation | McCarthy, O; Musso-Buendia, A; Kaiser, M; Brun, R; Ruiz-Perez, LM; Johansson, NG; Pacanowska, DG; Gilbert, IH Design, synthesis and evaluation of novel uracil acetamide derivatives as potential inhibitors of Plasmodium falciparum dUTP nucleotidohydrolase. Eur J Med Chem44:678-88 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
---|
Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
Type: | Enzyme |
Mol. Mass.: | 26574.03 |
Organism: | Homo sapiens (Human) |
Description: | P33316 |
Residue: | 252 |
Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
BDBM50266819 |
---|
n/a |
---|
Name | BDBM50266819 |
Synonyms: | 1-(6-(tert-butyldiphenylsilylamino)hexyl)pyrimidine-2,4(1H,3H)-dione | CHEMBL515610 |
Type | Small organic molecule |
Emp. Form. | C26H35N3O2Si |
Mol. Mass. | 449.6605 |
SMILES | CC(C)(C)[Si](NCCCCCCn1ccc(=O)[nH]c1=O)(c1ccccc1)c1ccccc1 |
Structure |
|