| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Ligand | BDBM50190543 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_564957 (CHEMBL957492) |
|---|
| Ki | 200±n/a nM |
|---|
| Citation |  McCarthy, O; Musso-Buendia, A; Kaiser, M; Brun, R; Ruiz-Perez, LM; Johansson, NG; Pacanowska, DG; Gilbert, IH Design, synthesis and evaluation of novel uracil acetamide derivatives as potential inhibitors of Plasmodium falciparum dUTP nucleotidohydrolase. Eur J Med Chem44:678-88 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Synonyms: | dUTP pyrophosphatase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19574.43 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | Q8II92 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKS
NYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAAL
DNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY
|
|
|
|---|
| BDBM50190543 |
|---|
| n/a |
|---|
| Name | BDBM50190543 |
|---|
| Synonyms: | 1-((2R,4S,5R)-4-hydroxy-5-((tritylamino)methyl)-tetrahydrofuran-2-yl)pyrimidine-2,4(1H,3H)-dione | 1-((2R,4S,5R)-4-hydroxy-5-((tritylamino)methyl)tetrahydrofuran-2-yl)pyrimidine-2,4(1H,3H)-dione | CHEMBL377582 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H27N3O4 |
|---|
| Mol. Mass. | 469.5317 |
|---|
| SMILES | O[C@H]1C[C@@H](O[C@@H]1CNC(c1ccccc1)(c1ccccc1)c1ccccc1)n1ccc(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
