| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50246466 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_557998 (CHEMBL965593) |
|---|
| IC50 | 120±n/a nM |
|---|
| Citation |  Fan, J; Fahr, B; Stockett, D; Chan, E; Cheeti, S; Serafimova, I; Lu, Y; Pham, P; Walker, DH; Hoch, U; Choong, IC Modifications of the isonipecotic acid fragment of SNS-032: analogs with improved permeability and lower efflux ratio. Bioorg Med Chem Lett18:6236-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50246466 |
|---|
| n/a |
|---|
| Name | BDBM50246466 |
|---|
| Synonyms: | (3R,5S)-N-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2-yl)-5-methylpiperidine-3-carboxamide | CHEMBL452602 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H26N4O2S2 |
|---|
| Mol. Mass. | 394.555 |
|---|
| SMILES | C[C@@H]1CNC[C@@H](C1)C(=O)Nc1ncc(SCc2ncc(o2)C(C)(C)C)s1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
