Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM50276064
Substrate/Competitorn/a
Meas. Tech.ChEMBL_492921
Ki 23±n/a nM
Citation Farmer LJBemis GBritt SDCochran JConnors MHarrington EMHoock TMarkland WNanthakumar STaslimi PTer Haar EWang JZhaveri DSalituro FG Discovery and SAR of novel 4-thiazolyl-2-phenylaminopyrimidines as potent inhibitors of spleen tyrosine kinase (SYK). Bioorg Med Chem Lett 18:6231-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50276064
n/a
NameBDBM50276064
Synonyms:CHEMBL470780 | N-(3,5-dimethylphenyl)-4-(5-methylthiazol-2-yl)pyrimidin-2-amine
TypeSmall organic molecule
Emp. Form.C16H16N4S
Mol. Mass.296.39
SMILESCc1cnc(s1)-c1ccnc(Nc2cc(C)cc(C)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: