| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50266027 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_540201 (CHEMBL1029830) |
|---|
| Ki | 1478±n/a nM |
|---|
| Citation |  Ballet, S; Feytens, D; Wachter, RD; Vlaeminck, MD; Marczak, ED; Salvadori, S; Graaf, C; Rognan, D; Negri, L; Lattanzi, R; Lazarus, LH; Tourwé, D; Balboni, G Conformationally constrained opioid ligands: the Dmt-Aba and Dmt-Aia versus Dmt-Tic scaffold. Bioorg Med Chem Lett19:433-7 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50266027 |
|---|
| n/a |
|---|
| Name | BDBM50266027 |
|---|
| Synonyms: | (S)-3-((S)-4-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanamido)-3-oxo-4,5-dihydro-1H-benzo[c]azepin-2(3H)-yl)-4-(benzylamino)-4-oxobutanoic acid | CHEMBL505855 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H36N4O6 |
|---|
| Mol. Mass. | 572.6514 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@H]1Cc2ccccc2CN([C@@H](CC(O)=O)C(=O)NCc2ccccc2)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
