| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1A |
|---|
| Ligand | BDBM50265759 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558363 (CHEMBL954165) |
|---|
| Ki | 876±n/a nM |
|---|
| Citation |  Butini, S; Gemma, S; Campiani, G; Franceschini, S; Trotta, F; Borriello, M; Ceres, N; Ros, S; Coccone, SS; Bernetti, M; De Angelis, M; Brindisi, M; Nacci, V; Fiorini, I; Novellino, E; Cagnotto, A; Mennini, T; Sandager-Nielsen, K; Andreasen, JT; Scheel-Kruger, J; Mikkelsen, JD; Fattorusso, C Discovery of a new class of potential multifunctional atypical antipsychotic agents targeting dopamine D3 and serotonin 5-HT1A and 5-HT2A receptors: design, synthesis, and effects on behavior. J Med Chem52:151-69 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1A |
|---|
| Name: | 5-hydroxytryptamine receptor 1A |
|---|
| Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46445.29 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Binding assays were performed using rat hippocampal membranes. |
|---|
| Residue: | 422 |
|---|
| Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
|---|
| BDBM50265759 |
|---|
| n/a |
|---|
| Name | BDBM50265759 |
|---|
| Synonyms: | CHEMBL497604 | N-[4-[4-(3-Cyanophenyl)piperazin-1-yl]butyl]benzo[b]furan-2-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26N4O2 |
|---|
| Mol. Mass. | 402.4888 |
|---|
| SMILES | O=C(NCCCCN1CCN(CC1)c1cccc(c1)C#N)c1cc2ccccc2o1 |
|---|
| Structure | 
|
|---|
Search and Browse
