Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 1 |
---|
Ligand | BDBM50248281 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_566225 (CHEMBL963306) |
---|
Ki | 100±n/a nM |
---|
Citation | Biju, P; Taveras, AG; Dwyer, MP; Yu, Y; Chao, J; Hipkin, RW; Fan, X; Rindgen, D; Fine, J; Lundell, D Fluoroalkyl alpha side chain containing 3,4-diamino-cyclobutenediones as potent and orally bioavailable CXCR2-CXCR1 dual antagonists. Bioorg Med Chem Lett19:1431-3 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 1 |
---|
Name: | C-X-C chemokine receptor type 1 |
Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
Type: | Enzyme |
Mol. Mass.: | 39803.83 |
Organism: | Homo sapiens (Human) |
Description: | P25024 |
Residue: | 350 |
Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
BDBM50248281 |
---|
n/a |
---|
Name | BDBM50248281 |
Synonyms: | (R)-3-(3,4-dioxo-2-(3,3,3-trifluoro-1-(furan-2-yl)propylamino)cyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL473145 |
Type | Small organic molecule |
Emp. Form. | C20H18F3N3O5 |
Mol. Mass. | 437.3692 |
SMILES | CN(C)C(=O)c1cccc(Nc2c(N[C@H](CC(F)(F)F)c3ccco3)c(=O)c2=O)c1O |r| |
Structure |
|