Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu/kappa/delta
LigandBDBM50248793
Substrate/Competitorn/a
Meas. Tech.ChEMBL_543309
Ki 0.043±n/a nM
Citation Cami-Kobeci GNeal APBradbury FAPurington LCAceto MDHarris LSLewis JWTraynor JRHusbands SM Mixed kappa/mu opioid receptor agonists: the 6 beta-naltrexamines. J Med Chem 52:1546-52 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu/kappa/delta
Name:Opioid receptors; mu/kappa/delta
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248793
n/a
NameBDBM50248793
Synonyms:17-Cyclopropylmethyl-3,14beta-dihydroxy-4,5alpha-epoxy-6beta-(cinnamoylamino)morphinan | CHEMBL473362
TypeSmall organic molecule
Emp. Form.C29H32N2O4
Mol. Mass.472.5754
SMILESOc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)[C@@H](CC[C@@]35O)NC(=O)\C=C\c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: