Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50278036
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501282
Ki 1.8±n/a nM
Citation Leblanc YRoy PDufresne CLachance NWang ZO'Neill GGreig GDenis DMathieu MCSlipetz DSawyer NTsou N Discovery of potent and selective DP1 receptor antagonists in the azaindole series. Bioorg Med Chem Lett 19:2125-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50278036
n/a
NameBDBM50278036
Synonyms:(+/-)-2-(5-(2,4-dichlorophenylthio)-4-(methylsulfonyl)-6,7,8,9-tetrahydropyrido[3,2-b]indolizin-6-yl)acetic acid | CHEMBL482547
TypeSmall organic molecule
Emp. Form.C20H18Cl2N2O4S2
Mol. Mass.485.404
SMILESCS(=O)(=O)c1ccnc2n3CCCC(CC(O)=O)c3c(Sc3ccc(Cl)cc3Cl)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: