Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
LigandBDBM27497
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501487
Kd 700±n/a nM
Citation Lehtiö LJemth ASCollins RLoseva OJohansson AMarkova NHammarström MFlores AHolmberg-Schiavone LWeigelt JHelleday TSchüler HKarlberg T Structural basis for inhibitor specificity in human poly(ADP-ribose) polymerase-3. J Med Chem 52:3108-11 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
Synonyms:(ARTD3 or PARP3) | ADP-ribosyltransferase diphtheria toxin-like 3 | Poly [ADP-ribose] polymerase 3 | Poly [ADP-ribose] polymerase 3 (PARP-3) | Poly(ADP-ribose) polymerase-3 (ARTD3/PARP3)
Type:PROTEIN
Mol. Mass.:60071.85
Organism:Homo sapiens (Human)
Description:n/a
Residue:533
Sequence:
MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNHWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27497
n/a
NameBDBM27497
Synonyms:2-(dimethylamino)-N-(6-oxo-5,6-dihydrophenanthridin-2-yl)acetamide | 2-Dimethylamino-N-(6-oxo-5,6-dihydro-phenanthridin-2-yl)-acetamide | CHEMBL372303 | N-(6-oxo-5,6-dihydro- phenanthridin-2-yl)-N,N-dimethylacetamide | N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE | PJ34
TypeSmall organic molecule
Emp. Form.C17H17N3O2
Mol. Mass.295.3358
SMILESCN(C)CC(=O)Nc1ccc2[nH]c(=O)c3ccccc3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: