| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50085160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_4312 (CHEMBL618420) |
|---|
| IC50 | 122±n/a nM |
|---|
| Citation |  Prasit, P; Belley, M; Brideau, C; Chan, C; Charleson, S; Evans, JF; Fortin, R; Ford-Hutchinson, AW; Gillard, JW; Guay, J; Hutchinson, JH; Léger, S; Riendeau, D; Young, RN; Zamboni, R A new class of leukotriene biosynthesis inhibitors: The discovery of MK0591 Bioorg Med Chem Lett2:1395-1398 (1992) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50085160 |
|---|
| n/a |
|---|
| Name | BDBM50085160 |
|---|
| Synonyms: | CHEMBL32842 | L-674636 | {4-(4-Chloro-phenyl)-1-[4-(quinolin-2-ylmethoxy)-phenyl]-butylsulfanyl}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H26ClNO3S |
|---|
| Mol. Mass. | 492.029 |
|---|
| SMILES | OC(=O)CSC(CCCc1ccc(Cl)cc1)c1ccc(OCc2ccc3ccccc3n2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
