| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50280995 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201267 |
|---|
| IC50 | 6±n/a nM |
|---|
| Citation |  Reddy, NL; Fischer, JB; Burke-Howie, KJ; Barmettler, P; Rhodes, MR; Weber, E; Keana, JF N,N′-disubstituted acetamidines as high affinity sigma receptor ligands Bioorg Med Chem Lett3:2113-2116 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50280995 |
|---|
| n/a |
|---|
| Name | BDBM50280995 |
|---|
| Synonyms: | CHEMBL542638 | N-Adamantan-1-yl-N'-o-tolyl-acetamidine; hydrochloride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N2 |
|---|
| Mol. Mass. | 282.4231 |
|---|
| SMILES | CC(NC12CC3CC(CC(C3)C1)C2)=Nc1ccccc1C |w:13.16,TLB:2:3:10:7.6.8,2:3:5.6.10:8,12:3:10:7.6.8,THB:4:3:5.6.10:8,4:5:3.12.11:8,12:7:3.4.11:10| |
|---|
| Structure | 
|
|---|
Search and Browse
