new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50282600
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195791
IC50 41±n/a nM
Citation Smith SAAl-Barazanji KABuckingham RECassidy FColdwell MCFinney FJHadley MSHam PLawrence SANash DJTingley EJWatson JM The identification of a novel renin inhibitor of equivalent efficacy following oral or intravenous administration. Bioorg Med Chem Lett 4:1291-1296 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282600
n/a
NameBDBM50282600
Synonyms:(3S,4S)-5-Cyclohexyl-4-((S)-2-{(S)-2-[2-(1,1-dioxo-2,3-dihydro-1H-1lambda*6*-benzo[b]thiophen-3-yl)-acetylamino]-3-phenyl-propionylamino}-4-methyl-pentanoylamino)-3-hydroxy-pentanoic acid (2-imidazol-1-yl-ethyl)-amide | CHEMBL23071
TypeSmall organic molecule
Emp. Form.C41H56N6O7S
Mol. Mass.776.984
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CC1CS(=O)(=O)c2ccccc12)C(=O)N[C@@H](CC1CCCCC1)[C@@H](O)CC(=O)NCCn1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: