| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50283054 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_98506 (CHEMBL709168) |
|---|
| Ki | 0.140000±n/a nM |
|---|
| Citation |  Sawyer, J; Schmittling, EA; Bach, NJ; Baker, S; Froelich, LL; Saussy, DL; Marder, P; Jackson, WT Structural analogues of LY292728, a highly potent xanthone dicarboxylic acid leukotriene B4 receptor antagonist: spatial positioning of the secondary acid group Bioorg Med Chem Lett4:2077-2082 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50283054 |
|---|
| n/a |
|---|
| Name | BDBM50283054 |
|---|
| Synonyms: | 4-{2-(2-Carboxy-ethyl)-3-[3-(5-ethyl-4'-fluoro-2-hydroxy-biphenyl-4-yloxy)-propoxy]-phenoxy}-benzoic acid | CHEMBL262231 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H31FO8 |
|---|
| Mol. Mass. | 574.5928 |
|---|
| SMILES | CCc1cc(c(O)cc1OCCCOc1cccc(Oc2ccc(cc2)C(O)=O)c1CCC(O)=O)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
