| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50283153 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79468 |
|---|
| IC50 | 88±n/a nM |
|---|
| Citation |  Smith, RA; Coles, PJ; Chen, JJ; Robinson, VJ; MacDonald, I; Carrière, J; Krantz, A Design, synthesis, and activity of conformationally-constrained macrocyclic peptide-based inhibitors of HIV protease Bioorg Med Chem Lett4:2217-2222 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50283153 |
|---|
| n/a |
|---|
| Name | BDBM50283153 |
|---|
| Synonyms: | 2-[23-[2-[3-(tert-butylcarbamoyl)-(3S,4aS,8aS)-perhydro-2-isoquinolinyl]-1-hydroxy-(1R)-ethyl]-18,21-dioxo-(20S,23S)-2,7-dioxa-19,22-diazatetracyclo[23.2.2.08,17.010,15]nonacosa-1(27),8,10,12,14,16,25,28-octaen-20-yl]acetamide | CHEMBL430984 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H57N5O7 |
|---|
| Mol. Mass. | 755.942 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CC2CCCCC2CN1C[C@@H](O)[C@@H]1Cc2ccc(OCCCCOc3cc4ccccc4cc3C(=O)N[C@@H](CC(N)=O)C(=O)N1)cc2 |
|---|
| Structure | 
|
|---|
Search and Browse
