| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50283470 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_86540 |
|---|
| Ki | 29000±n/a nM |
|---|
| Citation |  Romeo, G; Russo, F; Guccione, S; Chabin, R; Kuo, D; Knight, WB Synthesis of new thiazinoindole derivatives and their evaluation as inhibitors of human leukocyte elastase and other related serine proteases Bioorg Med Chem Lett4:2399-2404 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50283470 |
|---|
| n/a |
|---|
| Name | BDBM50283470 |
|---|
| Synonyms: | 2-(4-Chloro-phenylamino)-5H-[1,3]thiazino[5,4-b]indol-4-one | CHEMBL79118 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H10ClN3OS |
|---|
| Mol. Mass. | 327.788 |
|---|
| SMILES | Oc1sc(Nc2ccc(Cl)cc2)nc2c1nc1ccccc21 |
|---|
| Structure | 
|
|---|
Search and Browse
