Reaction Details |
| Report a problem with these data |
Target | Type-1 angiotensin II receptor |
---|
Ligand | BDBM50035451 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_36629 |
---|
IC50 | 0.450000±n/a nM |
---|
Citation | Chang, LL; Ashton, WT; Flanagan, KL; Rivero, RA; Chen, TB; O'Malley, SS; Zingaro, GJ; Kivlighn, SD; Siegl, PK; Lotti, VJ; Chang, RS; Greenlee, WJ Potent triazolinone-based angiotensin II receptor antagonists with equivalent affinity for both the AT1 and AT2 subtypes Bioorg Med Chem Lett4:2787-2792 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Type-1 angiotensin II receptor |
---|
Name: | Type-1 angiotensin II receptor |
Synonyms: | AGTR1 | AGTR1_RABIT | ANGIOTENSIN AT1 | Angiotensin II receptor | Angiotensin II type 1a (AT-1a) receptor |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 41009.15 |
Organism: | RABBIT |
Description: | ANGIOTENSIN AT1 AGTR1 RABBIT::P34976 |
Residue: | 359 |
Sequence: | MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
|
|
|
BDBM50035451 |
---|
n/a |
---|
Name | BDBM50035451 |
Synonyms: | 2-{4-[3-butyl-5-oxo-1-(2-trifluoromethylphenyl)-4,5-dihydro-1H-1,2,4-triazol-4-ylmethyl]phenyl}-1-(N-t-butoxycarbonyl)benzenesulfonamide | 4'-[3-Butyl-5-oxo-1-(2-trifluoromet hyl-phenyl)-15-dihydro-[124]tria zol-4-ylmethyl]-biphenyl-2-sulfonic acid t-butyloxycarbonylamide (L-162234) | 4'-[3-Butyl-5-oxo-1-(2-trifluoromethyl-phenyl)-1,5-dihydro-[1,2,4]triazol-4-ylmethyl]-biphenyl-2-sulfonic acid (2-tert-butoxycarbonyl)amide | 4'-[3-Butyl-5-oxo-1-(2-trifluoromethyl-phenyl)-1,5-dihydro-[1,2,4]triazol-4-ylmethyl]-biphenyl-2-sulfonic acid amide-N-carbonyoxylterbutyl | 5-n-Butyl-4-[[2'-[N-(tert-butoxycarbonyl)sulfamoyl]biphenyl-4yl]methyl]-2-[2-trifluoromethyl-phenyl]-2,4-dihydro-3H-1,2,4-triazol-3-one | CHEMBL292150 | L-162234 |
Type | Small organic molecule |
Emp. Form. | C31H33F3N4O5S |
Mol. Mass. | 630.678 |
SMILES | CCCCc1nn(-c2ccccc2C(F)(F)F)c(=O)n1Cc1ccc(cc1)-c1ccccc1S(=O)(=O)NC(=O)OC(C)(C)C |
Structure |
|