| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM50284086 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201045 (CHEMBL804074) |
|---|
| Ki | >3448±n/a nM |
|---|
| Citation |  Haadsma-Svensson, SR; Smith, MW; Lin, CH; Duncan, JN; Sonesson, C; Wikström, H; Waters, N; Carlsson, A; Svensson, K Synthesis and biological activity of C-5 modified derivatives of (+)-AJ76 and (+)-UH232: Increased dopamine D3 receptor preference and improved pharmacokinetic properties Bioorg Med Chem Lett4:689-694 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40266.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P47898 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
|---|
| BDBM50284086 |
|---|
| n/a |
|---|
| Name | BDBM50284086 |
|---|
| Synonyms: | CHEMBL161811 | Trifluoro-methanesulfonic acid (5S,6R)-6-dipropylamino-5-methyl-5,6,7,8-tetrahydro-naphthalen-1-yl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H26F3NO3S |
|---|
| Mol. Mass. | 393.464 |
|---|
| SMILES | CCCN(CCC)[C@@H]1CCc2c(OS(=O)(=O)C(F)(F)F)cccc2[C@@H]1C |
|---|
| Structure | 
|
|---|
Search and Browse
