new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 5-lipoxygenase
LigandBDBM50284680
Substrate/Competitorn/a
Meas. Tech.ChEBML_3964
IC50 1900±n/a nM
Citation Andrews EGAntognoli GWBreslow RCarta MPCarty TJChambers RJCheng JBCohan VLCollins JLDamon DBDelehunt JEggler JFEskra JDFreiert KWHada WAMarfat AMasamune HMelvin LSMularski CJNaclerio BA Synthesis and pharmacological profile of two novel heterocyclic chromanols, CP-80,798 and CP-85,958, as potent LTD4 receptor antagonists Bioorg Med Chem Lett 5:1365-1370 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 5-lipoxygenase
Name:Arachidonate 5-lipoxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:78082.31
Organism:Rattus norvegicus
Description:ChEMBL_1432947
Residue:673
Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDE
ELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLAR
DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN
YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC
NPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC
THQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFH
IHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGL
FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEA
IQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT
VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH
LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYY
YLSPDRIPNSVAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284680
n/a
NameBDBM50284680
Synonyms:(3S,4S)-3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | 3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | CHEMBL282524 | CP-80798
TypeSmall organic molecule
Emp. Form.C25H22N2O3
Mol. Mass.398.4538
SMILESO[C@H]1[C@@H](Cc2cccnc2)COc2ccc(OCc3ccc4ccccc4n3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: