| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50284934 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159320 |
|---|
| IC50 | 220±n/a nM |
|---|
| Citation |  Ahmad, S; Ashfaq, A; Alam, M; Bisacchi, GS; Chen, P; Cheng, PT; Greytok, JA; Hermsmeier, MA; Lin, PF; Lis, KA; Merchant, Z; Mitt, T; Skoog, M; Spergel, SH; Tino, JA; Vite, GD; Colonno, RJ; Zahler, R; Barrish, JC α-hydroxyamide derived aminodiols as potent inhibitors of hiv protease Bioorg Med Chem Lett5:1729-1734 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50284934 |
|---|
| n/a |
|---|
| Name | BDBM50284934 |
|---|
| Synonyms: | ((1S,2R)-1-Benzyl-2-hydroxy-3-{(2R,3S)-2-hydroxy-3-[(3-hydroxy-4,4-dimethyl-tetrahydro-furan-3-carbonyl)-amino]-4-phenyl-butylamino}-propyl)-carbamic acid tert-butyl ester | CHEMBL46067 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H47N3O7 |
|---|
| Mol. Mass. | 585.7315 |
|---|
| SMILES | CC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CNC[C@@H](O)[C@H](Cc1ccccc1)NC(=O)C1(O)COCC1(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
