new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50285993
Substrate/Competitorn/a
Meas. Tech.ChEBML_155158
Ki 1.7±n/a nM
Citation Holms JHDavidsen SKSheppard GSCarrera GMCurtin NLHeyman HRPireh DSteinman DHAlbert DHConway RGLuo GMagoc TJTapang PRhein DASummers JB Discovery and optimization of indole pyrrolothiazole paf antagonists Bioorg Med Chem Lett 5:2903-2908 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285993
n/a
NameBDBM50285993
Synonyms:6-(4-Fluoro-phenoxy)-3-(3-pyridin-3-yl-1H-pyrrolo[1,2-c]thiazole-7-carbonyl)-indole-1-carboxylic acid dimethylamide | CHEMBL99528
TypeSmall organic molecule
Emp. Form.C29H23FN4O3S
Mol. Mass.526.581
SMILESCN(C)C(=O)n1cc(C(=O)c2ccn3C(SCc23)c2cccnc2)c2ccc(Oc3ccc(F)cc3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: