new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50039631
Substrate/Competitorn/a
Meas. Tech.ChEMBL_86698
KON 900000 M-1s-1
Citation Hlasta DJBell MRCourt JJCundy KCDesai RCFerguson EWGordon RJKumar VMaycock ALSubramanyam CDunlap RPEiff SLFranke CAMura AJRowlands AG The design of potent and stable benzisothiazolone inhibitors of human leukocyte elastase Bioorg Med Chem Lett 5:331-336 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039631
n/a
NameBDBM50039631
Synonyms:2,6-Dichloro-benzoic acid 4-isopropyl-1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester | CHEMBL314218
TypeSmall organic molecule
Emp. Form.C18H15Cl2NO5S
Mol. Mass.428.286
SMILESCC(C)c1cccc2c1C(=O)N(COC(=O)c1c(Cl)cccc1Cl)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: