Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50286542 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_195356 |
---|
IC50 | 17±n/a nM |
---|
Citation | Young, SD; Amblard, MC; Britcher, SF; Grey, VE; Tran, LO; Lumma, WC; Huff, JR; Schleif, WA; Emini, EE; O'Brien, JA; Pettibone, DJ 2-Heterocyclic indole-3-sulfones as inhibitors of HIV-1 reverse transcriptase Bioorg Med Chem Lett5:491-496 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50286542 |
---|
n/a |
---|
Name | BDBM50286542 |
Synonyms: | 3-Benzenesulfonyl-5-chloro-2-(4,5-dihydro-thiazol-2-yl)-1H-indole | CHEMBL144742 |
Type | Small organic molecule |
Emp. Form. | C17H13ClN2O2S2 |
Mol. Mass. | 376.88 |
SMILES | Clc1ccc2[nH]c(C3=NCCS3)c(c2c1)S(=O)(=O)c1ccccc1 |t:7| |
Structure |
|