| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM50286661 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_151697 (CHEMBL880989) |
|---|
| IC50 | 25±n/a nM |
|---|
| Citation |  Hussoin, MS; Cai, X; Scannell, RT; Yaeger, D; Killian, DB; Eckman, J; Hwang, SB; Libertine-Garahan, L; Qian, C; Yen, CG; Ip, S Cmi-206: A potent dual platelet activating factor antagonist and 5-lipoxygenase inhibitor Bioorg Med Chem Lett5:643-648 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39219.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
|---|
| BDBM50286661 |
|---|
| n/a |
|---|
| Name | BDBM50286661 |
|---|
| Synonyms: | CHEMBL160290 | N-hydroxy-N'-[3-methoxy-5-(5-(3,4,5-trimethoxyphenyl)tetrathydrofuran-2-yl)-2-propoxyphenyl]-N-(sec-butyl)-N-hydroxyurea |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H40N2O8 |
|---|
| Mol. Mass. | 532.6258 |
|---|
| SMILES | CCCOc1c(NC(=O)N(O)C(C)CC)cc(cc1OC)C1CCC(O1)c1cc(OC)c(OC)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
