Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM3414 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159623 |
---|
IC50 | 1.4±n/a nM |
---|
Citation | Kaldor, SW; Appelt, K; Fritz, JE; Hammond, M; Crowell, TA; Baxter, AJ; Hatch, SD; Wiskerchen, M; Muesing, MA A systematic study of P1–P3 spanning sidechains for the inhibition of HIV-1 protease Bioorg Med Chem Lett5:715-720 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM3414 |
---|
n/a |
---|
Name | BDBM3414 |
Synonyms: | (2S)-N-[(2S,3R)-4-[2-(tert-butylcarbamoyl)phenyl]-3-hydroxy-1-phenylbutan-2-yl]-2-(quinolin-2-ylformamido)butanediamide | LY289612 |
Type | Small organic molecule |
Emp. Form. | C35H39N5O5 |
Mol. Mass. | 609.7147 |
SMILES | CC(C)(C)NC(=O)c1ccccc1C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1 |r| |
Structure |
|