new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral Endopeptidase (NEP)
LigandBDBM50287700
Substrate/Competitorn/a
Meas. Tech.ChEBML_144623
Ki 0.500000±n/a nM
Citation Beight DWMehdi SKoehl JRFlynn GA Synthesis of constrained thiorphan analogs as inhibitors of neutral endopeptidase Bioorg Med Chem Lett 6:2053-2058 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Neutral Endopeptidase (NEP)
Name:Neprilysin
Synonyms:Neutral endopeptidase 24.11
Type:Protein
Mol. Mass.:85789.59
Organism:Rattus norvegicus (Rat)
Description:P07861
Residue:750
Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287700
n/a
NameBDBM50287700
Synonyms:(S)-3-(4-Hydroxy-phenyl)-2-[(2-mercaptomethyl-1,2,3,4-tetrahydro-naphthalene-2-carbonyl)-amino]-propionic acid benzyl ester | CHEMBL294760
TypeSmall organic molecule
Emp. Form.C28H29NO4S
Mol. Mass.475.599
SMILESOc1ccc(C[C@H](NC(=O)C2(CS)CCc3ccccc3C2)C(=O)OCc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: