new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinic acetylcholine receptor alpha9/alpha10
LigandBDBM50287814
Substrate/Competitorn/a
Meas. Tech.ChEBML_143222
Ki 5±n/a nM
Citation Elliott RLKopecka HGunn DELin NHGarvey DSRyther KBHolladay MWAnderson DJCampbell JESullivan JPBuckley MJGunther KLO'Neill ABDecker MWArnerić SP 2-(Aryloxymethyl) azacyclic analogues as novel nicotinic acetylcholine receptor (nAChR) ligands Bioorg Med Chem Lett 6:2283-2288 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinic acetylcholine receptor alpha9/alpha10
Name:Nicotinic acetylcholine receptor alpha9/alpha10
Synonyms:Neuronal acetylcholine receptor protein alpha-10 subunit
Type:PROTEIN
Mol. Mass.:49830.54
Organism:Rattus norvegicus
Description:ChEMBL_143222
Residue:447
Sequence:
MGTRSHYLDLGFLLLLFLPAECLGAEGRLAHKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSRLVWRPDIVLYN
KADTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHGGH
QLDVRPRGTSASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCVRERGEPCGQS
KPLESAPSLQPPPASPAGPCHEPRCLCHQEALLHHIASIASTFRSHRAAQRRHEDWKRLA
RVMDRFFLGIFFCMALVMSLIVLVQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287814
n/a
NameBDBM50287814
Synonyms:(S)-2-(3-Fluoro-phenoxymethyl)-1-methyl-pyrrolidine | CHEMBL74249
TypeSmall organic molecule
Emp. Form.C12H16FNO
Mol. Mass.209.2599
SMILESCN1CCC[C@H]1COc1cccc(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: